PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA68G00014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 271aa    MW: 30733.4 Da    PI: 6.9638
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA68G00014genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.9e-082872345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     +WT+eE +++ +a + + ++   +W ++a++++ g+t  +++  + 
       AA68G00014 28 KWTAEENKKFENALAYYDKDtpdRWFKVAAMLP-GKTVGDVIKQYK 72
                     8********************************.****99988875 PP

2Myb_DNA-binding48.81.6e-15140184347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
       AA68G00014 140 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 184
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-42373IPR009057Homeodomain-like
PROSITE profilePS512939.2622479IPR017884SANT domain
SMARTSM007171.7E-92577IPR001005SANT/Myb domain
SuperFamilySSF466899.72E-122781IPR009057Homeodomain-like
CDDcd001672.64E-72874No hitNo description
PfamPF002499.8E-72872IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-13131190IPR009057Homeodomain-like
PROSITE profilePS5129421.845133189IPR017930Myb domain
SuperFamilySSF466891.51E-17135188IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-18136188IPR006447Myb domain, plants
SMARTSM007178.7E-14137187IPR001005SANT/Myb domain
PfamPF002496.7E-13140184IPR001005SANT/Myb domain
CDDcd001671.33E-11140185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MNRGMEIVSA TSYLETSNWL FQENKGTKWT AEENKKFENA LAYYDKDTPD RWFKVAAMLP  60
GKTVGDVIKQ YKELEEDVSD IEAGLIPIPG YTSDSFTLEW GGDRASTGNN GFNMNGFYFA  120
GGKRGSALRS SEHERKKGVP WTEEEHRQFL MGLKKYGKGD WRNIARNFVT TRTPTQVASH  180
AQKYFIRQVN GGKDKRRSSI HDITTVNIPD ELPDDAITTA NAPCSPPPLI KTQRLYNNQN  240
AAFMGMTSTA YMPLLQEQGF QFEAYDSYLQ M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-172693875RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294698.11e-159hypothetical protein CARUB_v10023736mg
SwissprotQ8S9H73e-94DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0FXY91e-159R0FXY9_9BRAS; Uncharacterized protein
STRINGAT2G38090.11e-154(Arabidopsis thaliana)
STRINGBra005139.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-144MYB family protein